Share on facebook
Share on twitter
Share on reddit
Share on telegram
Share on print

Erythropoietin

Package Dosage PriceQuantity
5 vials3000 iu/vial $112.50
10 vials3000 iu/vial $216.00
15 vials3000 iu/vial $297.00
20 vials3000 iu/vial $360.00
Administration

Regular injectable form

CAS Number

11096-26-7

Molecular Formula

C815H1317N233O241S5

Molecular Mass

18396.1 g/mol

Other Names

E.P.O., Erythropoietin, Epoetin alfa, Epoetin alfa recombinant, Epoetin beta, Epoetin epsilon, Epoetin gamma, Epoetin gamma rDNA, Epoetin kappa, Epoetin omega, Epoetin theta

Peptide Sequence

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder

Shipping Terms

Shipped at Room temp.

Package

10 vials, 15 vials, 20 vials, 5 vials

Dosage

3000 iu/vial

All orders greater than $250.00 ship worldwide for free.

We’ve a Special Offer today!

10% discount Your First Order

on all products.
Get Coupon
Hurry up! Offer valid till tomorrow.
close-link