15% OFF FOR BITCOIN PAYMENTS

Erythropoietin

$140.88$414.00

Package Dosage PriceQuantity
5 vials3000 iu/vial $140.88
10 vials3000 iu/vial $258.75
15 vials3000 iu/vial $345.00
20 vials3000 iu/vial $414.00
SKU: N/A Category: Tags: ,

What Is Erythropoietin?

Erythropoietin, often known as EPO, is a very important hormone that stimulates the production of red blood cells in the bone marrow and extends their life in the body. As you will know, red blood cells carry oxygen from the lungs around the body, enabling the muscles to work harder and more efficiently. Erythropoietin is a natural substance produced by normal healthy kidneys. It is produced artificially in the laboratory using cell cultures and recombinant DNA technology; its medical uses include the treatment of anemia, that is, low levels of iron in the blood. Since 1983 Erythropoietin has been proved to be a safe and reliable treatment for people with a lower blood cell count than is healthy.

If you have a low red blood cell count, you will experience symptoms including shortness of breath, you will tire more easily and your endurance over both short and long term will be impaired. Erythropoietin can reverse these issues, and fast. Given by a simple subcutaneous (under the skin) injection, results are noticeable from the beginning of your course.

Erythropoietin Benefits

For the athlete and sportsman, the advantages of Erythropoietin are clear. If you can boost the red blood cells circulating in your body, they can deliver more oxygen to your muscles, enabling you to simply work harder and longer without fatigue and stress. Erythropoietin is a definite performance booster.

It’s very important to take Erythropoietin responsibly. You do need to stick to the recommended dose, and please, don’t think that taking a higher dose will lead to better results for your athletic and strength performance. The reverse can be true.

As when taking any performance-enhancing supplement, a sensible diet with a good balance between quality protein, vegetables and fruits, with a limited intake of carbohydrates, is recommended. Five servings of vegetables or fruit is ideal, and unless you have ethical concerns, we’d suggest that you include meat in your diet while you are taking Erythropoietin. It’s useful to take a moderate amount of iron-rich foods such as liver and spinach (yes, Popeye was right!) but don’t overdo it. You can take and an iron-based supplement when you are taking Erythropoietin and this may improve its effectiveness, although our preference is for an iron-rich diet as your first step.

You can exercise as normal, and you will be pleased to notice an almost immediate improvement in your strength, performance and general enjoyment of life. This is especially true if you have been, perhaps without knowing it, a little anemic before taking Erythropoietin.

Erythropoietin, unlike some other supplements, completely disappears from your urine within 48 hours and from your blood within 72 hours and can’t be detected, so your body gets back to its usual state very quickly.

Erythropoietin Results

You should expect to see quite fast and impressive results. You will immediately be able to work harder and more intensely, focus better on your training, and improve your strength and speed. You will tire less quickly, and your endurance will noticeably increase.

Taking Erythropoietin is not like taking an iron supplement. Erythropoietin works at the cellular level of the body, immediately increasing and supporting the health and production of your own natural red blood cells.

Administration

Regular injectable form.

CAS Number

11096-26-7

Molecular Formula

C815H1317N233O241S5

Molecular Mass

18396.1 g/mol

Other Names

E.P.O., Erythropoietin, Epoetin alfa, Epoetin alfa recombinant, Epoetin beta, Epoetin epsilon, Epoetin gamma, Epoetin gamma rDNA, Epoetin kappa, Epoetin omega, Epoetin theta

Peptide Sequence

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder

Shipping Terms

Shipped at Room temp.

Package

10 vials, 15 vials, 20 vials, 5 vials

Dosage

3000 iu/vial

All orders greater than $250.00 ship worldwide for free.