HGH 191AA

HGH 191AA

$152.10$468.00

In stock

$152.10$468.00

Package Dosage PriceQuantity
5 vials10 iu/vial $152.10
10 vials10 iu/vial $280.80
15 vials10 iu/vial $386.10
20 vials10 iu/vial $468.00
  • Additional information

Additional information

Administration

Regular injectable form

CAS Number

12629-01-05

Molecular Formula

C990H1529N263O299S7

Molecular Mass

22124.1 g/mol

Other Names

Somatotropin, Human growth hormone (177-191), Genotropin (Pharmacia); Humatrope (Lilly); Nutropin (Genentech); Saizen (Serono); Serostim (Serono).

Peptide Sequence

MFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder

Shipping Terms

Shipped at Room temp.

Package

10 vials, 15 vials, 20 vials, 5 vials

Dosage

10 iu/vial