Jintropin

$372.60$648.00

Package Dosage PriceQuantity
10 vials10 iu/vial $372.60
20 vials10 iu/vial $648.00
SKU: N/A Categories: ,

Additional information

Administration

Regular injectable form

CAS Number

12629-01-05

Molecular Formula

C990H1529N263O299S7

Molecular Mass

22124.1 g/mol

Other Names

Somatotropin, Human growth hormone (177-191), Genotropin (Pharmacia); Humatrope (Lilly); Nutropin (Genentech); Saizen (Serono); Serostim (Serono).

Peptide Sequence

MFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder

Shipping Terms

Shipped at Room temp.

Package

10 vials, 20 vials

Dosage

10 iu/vial